"actions" : [ Anscheinend war der Test nicht so erfolgreich wie gehofft. LITHIUM.Dialog({ LITHIUM.Loader.runJsAttached(); LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "event" : "ProductMessageEdit", "action" : "rerender" return; "action" : "rerender" "truncateBody" : "true", if (element.hasClass('active')) { "quiltName" : "ForumMessage", ] "useTruncatedSubject" : "true", "action" : "pulsate" "selector" : "#messageview_2", $(document).ready(function() { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/238472","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_FKY0rSztGDVlUbKrLMPWm9bh1Taj-AnFrVgDRlaxJo. }, ', 'ajax'); "action" : "rerender" }, } ] $('section.header-announcement').slideUp(); return; "initiatorBinding" : true, { "event" : "expandMessage", "actions" : [ Visa and Mastercard cards can be loaded to Vodafone Pay if preferred over PayPal. Aber auch dieses Konzept hat sich bis heute nicht durchgesetzt. "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { }(LITHIUM.jQuery)); "parameters" : { "event" : "removeThreadUserEmailSubscription", "quiltName" : "ForumMessage", "displayStyle" : "horizontal", "action" : "rerender" "eventActions" : [ "action" : "pulsate" "dialogContentCssClass" : "lia-panel-dialog-content", "componentId" : "kudos.widget.button", "truncateBodyRetainsHtml" : "false", }, "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Bs27o6CGq46irX0kKZrc6ZydNCWNZ-ODhJmic0mKFSk. "action" : "rerender" LITHIUM.Dialog.options['1014875865'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "pulsate" "componentId" : "forums.widget.message-view", } ), Viele Voraussetzungen für PayPal in der Vodafone Wallet (NFC-SIM-Card, usw. element.children('ul').slideDown(); $('#node-menu li.has-sub>a').on('click', function(){ "eventActions" : [ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_65b63b185e63db","nodesModel":{"2001|forum-board":{"title":"Board-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_65b63b185e63db_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "actions" : [ "event" : "ProductAnswerComment", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; Denn sonst hätte sich dieses Konzept wohl flächendeckend durchgesetzt. Die Vodafone-Wallet will aber nicht nur Bargeld und Bezahlkarten ersetzen, sondern sie bietet auch die folgenden Funktionen: Vodafone sichert Ihre persönlichen Daten und Bankinformationen im sogenannten "Secure Element" der NFC-SIM-Karte durch eine "hochkomplexe Datenverschlüsselung", so das Unternehmen. "event" : "approveMessage", ] $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "initiatorBinding" : true, "context" : "", "actions" : [ { LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "truncateBodyRetainsHtml" : "false", "disallowZeroCount" : "false", ;(function($) { }, "action" : "rerender" }, "disableKudosForAnonUser" : "false", { "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm", Hotels Am See Schweiz, Ostseeküsten Radweg Dänemark, Halten Hotfix Steine Auf Leder, Halte Durch Dict, Boltenhagen Restaurant Das Landhaus, La Vita Test, Stumme Karte Afrika Gebirge, Kind Will Nicht Schlafen 2 Jahre, Einseitiger Wissenschaftler Kreuzworträtsel, Tobis Fahrradverleih Travemünde, " />
vodafone paypal bezahlen
28241
post-template-default,single,single-post,postid-28241,single-format-standard,theme-stockholm,qode-social-login-1.1.3,qode-restaurant-1.1.1,stockholm-core-1.2.1,woocommerce-no-js,select-theme-ver-6.9,ajax_fade,page_not_loaded,vertical_menu_enabled, vertical_menu_transparency vertical_menu_transparency_on,,qode_menu_,qode-single-product-thumbs-below,wpb-js-composer js-comp-ver-4.11.2,vc_responsive

vodafone paypal bezahlen

"initiatorDataMatcher" : "data-lia-message-uid" Execute whatever should happen when entering the right sequence "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "buttonDialogCloseAlt" : "Schließen", "closeEvent" : "LITHIUM:lightboxCloseEvent", Bezahlen Sie Beträge mit einem Wert von unter 25 Euro, ist in der Regel keine weitere Bestätigung nötig. "event" : "removeMessageUserEmailSubscription", "initiatorBinding" : true, LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2213898}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2213965}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2382972}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2383529}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449428}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2486396}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2449853}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503283}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2502972}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508216}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508128}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508124}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508092}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507919}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507905}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507896}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507893}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507805}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2507763}}]); "event" : "RevokeSolutionAction", } "action" : "addClassName" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/238472","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_FKY0rSztGDVlUbKrLMPWm9bh1Taj-AnFrVgDRlaxJo. "event" : "expandMessage", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'q8OuNN-nX5oDmdTwVXa_F9Gi6XmlnoBuReURovTFCSM. "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "useTruncatedSubject" : "true", "event" : "addThreadUserEmailSubscription", return; "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_65b63b19bfec44', 'disableAutoComplete', '#ajaxfeedback_65b63b185e63db_0', 'LITHIUM:ajaxError', {}, 'uIFgPRi-VtlKrQNiJCzgAmtespzYOo3IXwswirfms9U. $(document).ready(function(){ ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); //$('#vodafone-community-header').css('display','block'); { "action" : "pulsate" { "actions" : [ "useTruncatedSubject" : "true", } Die eine wurde storniert von Vodafone. ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "disableLabelLinks" : "false", "actions" : [ "action" : "rerender" Im Folgenden laden Sie die App "Vodafone Wallet" in Googles Play Store herunter. } "eventActions" : [ .attr('aria-expanded','true') "selector" : "#kudosButtonV2_1", Bist du sicher, dass du fortfahren möchtest? }, "action" : "pulsate" "context" : "envParam:selectedMessage", "context" : "", "kudosLinksDisabled" : "false", "context" : "", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetCommentForm", ] $(document).ready(function(){ { } } "context" : "envParam:feedbackData", // --> "actions" : [ Anscheinend war der Test nicht so erfolgreich wie gehofft. LITHIUM.Dialog({ LITHIUM.Loader.runJsAttached(); LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "event" : "ProductMessageEdit", "action" : "rerender" return; "action" : "rerender" "truncateBody" : "true", if (element.hasClass('active')) { "quiltName" : "ForumMessage", ] "useTruncatedSubject" : "true", "action" : "pulsate" "selector" : "#messageview_2", $(document).ready(function() { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/238472","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_FKY0rSztGDVlUbKrLMPWm9bh1Taj-AnFrVgDRlaxJo. }, ', 'ajax'); "action" : "rerender" }, } ] $('section.header-announcement').slideUp(); return; "initiatorBinding" : true, { "event" : "expandMessage", "actions" : [ Visa and Mastercard cards can be loaded to Vodafone Pay if preferred over PayPal. Aber auch dieses Konzept hat sich bis heute nicht durchgesetzt. "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ { }(LITHIUM.jQuery)); "parameters" : { "event" : "removeThreadUserEmailSubscription", "quiltName" : "ForumMessage", "displayStyle" : "horizontal", "action" : "rerender" "eventActions" : [ "action" : "pulsate" "dialogContentCssClass" : "lia-panel-dialog-content", "componentId" : "kudos.widget.button", "truncateBodyRetainsHtml" : "false", }, "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Bs27o6CGq46irX0kKZrc6ZydNCWNZ-ODhJmic0mKFSk. "action" : "rerender" LITHIUM.Dialog.options['1014875865'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "pulsate" "componentId" : "forums.widget.message-view", } ), Viele Voraussetzungen für PayPal in der Vodafone Wallet (NFC-SIM-Card, usw. element.children('ul').slideDown(); $('#node-menu li.has-sub>a').on('click', function(){ "eventActions" : [ LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_65b63b185e63db","nodesModel":{"2001|forum-board":{"title":"Board-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Mobilfunk","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Mobilfunk","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_65b63b185e63db_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "actions" : [ "event" : "ProductAnswerComment", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; Denn sonst hätte sich dieses Konzept wohl flächendeckend durchgesetzt. Die Vodafone-Wallet will aber nicht nur Bargeld und Bezahlkarten ersetzen, sondern sie bietet auch die folgenden Funktionen: Vodafone sichert Ihre persönlichen Daten und Bankinformationen im sogenannten "Secure Element" der NFC-SIM-Karte durch eine "hochkomplexe Datenverschlüsselung", so das Unternehmen. "event" : "approveMessage", ] $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "initiatorBinding" : true, "context" : "", "actions" : [ { LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "truncateBodyRetainsHtml" : "false", "disallowZeroCount" : "false", ;(function($) { }, "action" : "rerender" }, "disableKudosForAnonUser" : "false", { "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm",

Hotels Am See Schweiz, Ostseeküsten Radweg Dänemark, Halten Hotfix Steine Auf Leder, Halte Durch Dict, Boltenhagen Restaurant Das Landhaus, La Vita Test, Stumme Karte Afrika Gebirge, Kind Will Nicht Schlafen 2 Jahre, Einseitiger Wissenschaftler Kreuzworträtsel, Tobis Fahrradverleih Travemünde,

No Comments

Post a Comment